.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gfg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form. To be published
    Site NYSGXRC
    PDB Id 3gfg Target Id NYSGXRC-11137j
    Related PDB Ids 3gdo 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS27065,CAB15358.1, 3.40.50.720 Molecular Weight 40092.33 Da.
    Residues 358 Isoelectric Point 5.56
    Sequence litllkgrrkvdtikvgilgyglsgsvfhgplldvldeyqiskimtsrteevkrdfpdaevvheleeit ndpaielvivttpsglhyehtmaciqagkhvvmekpmtataeegetlkraadekgvllsvyhnrrwdnd fltikklisegsledintyqvsynryrpevqarwrekegtatgtlydlgshiidqtlhlfgmpkavtan vmaqrenaetvdyfhltldygklqailyggsivpangpryqihgkdssfikygidgqedalragrkped dswgadvpefygklttirgsdkktetipsvngsyltyyrkiaesiregaalpvtaeeginviriieaam esskekrtimleh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 2.59 Rfree 0.236
    Matthews' coefficent 2.52 Rfactor 0.182
    Waters 516 Solvent Content 51.10

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3gfg

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch