.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g1w

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of sugar ABC transporter (sugar-binding protein) from Bacillus halodurans. To be Published
    Site NYSGXRC
    PDB Id 3g1w Target Id NYSGXRC-11229f
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS27146,3.40.50.2300, NP_244315.1, PF00072 Molecular Weight 36903.56 Da.
    Residues 335 Isoelectric Point 4.50
    Sequence mkklllvyvaliglfmlyvyhahfkepvanpwdtrglqgdlnetymmitfqsgmdywkrclkgfedaaq alnvtveyrgaaqydiqeqitvleqaiaknpagiaisaidpveltdtinkavdagipivlfdsgapdsh ahsflgtnnynagmnaaykmaelldgegevavitlpnqlnhqerttgfketleaefpaieviavedgrg dslhsrrvahqlledypnlagifateanggvgvgdavrlesrageiqiisfdtdkgtldlvdegiisat laqgtwnmgywsltylfhlhhgltepqilqtreeaplplyvdtgitivtdenvdyyyad
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.02 Rfree 0.23711
    Matthews' coefficent 2.23 Rfactor 0.19308
    Waters 229 Solvent Content 44.78

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3g1w

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch