.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fk4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of RuBisCO-like protein from Bacillus Cereus ATCC 14579. To be Published
    Site NYSGXRC
    PDB Id 3fk4 Target Id NYSGXRC-9463a
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS27032,PF00016, NP_833754 Molecular Weight 45460.71 Da.
    Residues 414 Isoelectric Point 6.38
    Sequence msgiiatylihddshnlekkaeqialgltigswthlphllqeqlkqhkgnvihveelaehehtnsylrk kvkrgiikieypllnfspdlpailtttfgklsldgevklidltfsdelkkhfpgpkfgidgirnllqvh drpllmsifkgmigrnigylktqlrdqaiggvdivkddeilfenaltpltkrivsgkevlqsvyetygh ktlyavnltgrtfdlkenakravqagadillfnvfaygldvlqslaeddeipvpimahpavsgaysask lygvssplllgkllryagadfslfpspygsvalekeealaiskylteddasfkksfsvpsagihpgfvp fivrdfgkdvvinagggihghpngaqgggkafrtaidatlqnkplhevddinlhsalqiwgnpsyevkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.257
    Matthews' coefficent 2.84 Rfactor 0.235
    Waters 160 Solvent Content 56.76

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3fk4

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch