The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative glucosidase lplD from bacillus subtilis. To be published
    Site NYSGXRC
    PDB Id 3fef Target Id NYSGXRC-11137c
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS27063,CAB12532.1, Molecular Weight 49451.87 Da.
    Residues 446 Isoelectric Point 5.47
    Sequence vfhistldqikiayigggsqgwarslmsdlsidermsgtvalydldfeaaqknevignhsgngrwryea vstlkkalsaadiviisilpgslddmevdvhlpercgiyqsvgdtvgpggiirglravpifaeiarair dyapeswvinytnpmsvctrvlykvfpgikaigcchevfgtqkllaemvterlgievprredirvnvlg inhftwitkasyrhidllpifrefsahygesgyelegecwrdsvfcsahrvafdlfetygaipaagdrh laeflpgpylkqpevwkfhltpisfrkqdraekrqeterlivqqrgvaekasgeegvniiaallglgel vtnvnmpnqgqvlnlpiqaivetnafitrnrvqpilsgalpkgvemlaarhisnqeavadagltkdtgl afqaflndplvqidrsdaeqlfndmlqcimqs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.243
    Matthews' coefficent 2.41 Rfactor 0.187
    Waters 535 Solvent Content 49.00

    Ligand Information
    Ligands SO4 (SULFATE) x 7
    Metals MG (MAGNESIUM) x 4


    Google Scholar output for 3fef

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch