The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a C2 domain from human synaptotagmin-like protein 4. To be Published
    Site NYSGXRC
    PDB Id 3fdw Target Id NYSGXRC-13071a
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS26968,NP_542775.1 Molecular Weight 76005.62 Da.
    Residues 671 Isoelectric Point 9.10
    Sequence mselldlsflseeekdlilsvlqrdeevrkadekrirrlknelleikrkgakrgsqhysdrtcarcqes lgrlspktntcrgcnhlvcrdcriqesngtwrckvcakeielkkatgdwfydqkvnrfayrtgseiirm slrhkpavskretvgqsllhqtqmgdiwpgrkiiqerqkepsvlfevpklksgksaleaesesldsfta dsdstsrrdsldksglfpewkkmsapksqveketqpggqnvvfvdegemifkkntrkilrpseytksvi dlrpedvvhesgslgdrsksvpglnvdmeeeeeeedidhlvklhrqklarssmqsgssmstigsmmsiy seagdfgnifvtgriafslkyeqqtqslvvhvkechqlayadeakkrsnpyvktyllpdksrqgkrkts ikrdtvnplydetlryeipesllaqrtlqfsvwhhgrfgrntflgeaeiqmdswkldkkldhclplhgk isaesptglpshkgelvvslkyipasktpvggdrkkskggeggelqvwikeaknltaakaggtsdsfvk gyllpmrnkaskrktpvmkktlnphynhtfvyngvrledlqhmcleltvwdreplasndflggvrlgvg tgisngevvdwmdstgeevslwqkmrqypgswaegtlqlrssmakqklgl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.280
    Matthews' coefficent 2.61 Rfactor 0.233
    Waters 134 Solvent Content 52.92

    Ligand Information


    Google Scholar output for 3fdw

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch