The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative enoyl-CoA hydratase/isomerase from Acinetobacter baumannii. To be Published
    Site NYSGXRC
    PDB Id 3fdu Target Id NYSGXRC-11252j
    Molecular Characteristics
    Source Acinetobacter sp.
    Alias Ids TPS27170,, PF00378, YP_047189.1 Molecular Weight 29282.17 Da.
    Residues 266 Isoelectric Point 5.76
    Sequence mtlqciqqphphlnanlengvltlalnraetknalygelylwlaqalddadqsndvrvvilrgadrdft agndmkdfmgfiqkpyegkagdqppfvllksaakfskplivaiqgvaigigvtillhadlvyadqtalf qipfvslglspegaasrllvkqagyhraaellftakkfnaelaekaglinqisddvytqahqialqlaa lplasikqskalmkqdladiikciddeaeifmqrvrspemkeavqafmqkrqpdfsqfs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.283
    Matthews' coefficent 2.32 Rfactor 0.226
    Waters 683 Solvent Content 46.91

    Ligand Information
    Ligands SO4 (SULFATE) x 4;GOL (GLYCEROL) x 1


    Google Scholar output for 3fdu

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch