.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f6a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hydrolase, NUDIX family from Clostridium perfringens. To be Published
    Site NYSGXRC
    PDB Id 3f6a Target Id NYSGXRC-11180h
    Molecular Characteristics
    Source Clostridium perfringens
    Alias Ids TPS27108,3.90.79.10, YP_695508.1 Molecular Weight 16833.56 Da.
    Residues 149 Isoelectric Point 5.88
    Sequence mnrhftvsvfivckdkvllhlhkkakkmlplgghievnelpeeacireakeeaglnvtlynpidinlkk scdlsgekllinpihtilgdvspnhshidfvyyatttsfetspeigeskilkwyskedlknahniqeni lvmatealdll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.02 Rfree 0.263
    Matthews' coefficent 2.12 Rfactor 0.226
    Waters 179 Solvent Content 42.06

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3f6a

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch