.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f1c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase from Listeria monocytogenes. To be Published
    Site NYSGXRC
    PDB Id 3f1c Target Id NYSGXRC-13862a
    Molecular Characteristics
    Source Listeria monocytogenes
    Alias Ids TPS24497,AAT03877.1, PF01128 Molecular Weight 26791.38 Da.
    Residues 237 Isoelectric Point 5.41
    Sequence miyaqilaggkgtrmgnvsmpkqflplngkpiivhtvekfilntrfdkilisspkewmnhaednikkyi sddrivvieggedrnetimngirfvektygltdddiivthdavrpflthriieenidaaletgavdtvi ealdtivessnhevitdipvrdhmyqgqtpqsfnmkkvfnhyqnltpekkqiltdackicllagddvkl vkgeifnikittpydlkvanaiiqeriand
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.27672
    Matthews' coefficent 2.43 Rfactor 0.24075
    Waters 67 Solvent Content 49.36

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3f1c
    1. Homology modeling of Mycobacterium tuberculosis 2C-methyl-d-erythritol-4-phosphate cytidylyltransferase, the third enzyme in the MEP pathway for isoprenoid
    C Obiol-Pardo, A Cordero, J Rubio-Martinez - Journal of molecular , 2010 - Springer
     
    2. Structural and functional studies of mycobacterial IspD enzymes
    C Bjorkelid, T Bergfors, LM Henriksson - Section D: Biological , 2011 - scripts.iucr.org
     
    3. 2C-methyl-D-erythritol-4-phosphate cytidylyltransferase, the third enzyme in the MEP pathway for isoprenoid biosynthesis
    C Obiol-Pardo, A Cordero, J Rubio-Martinez, S Imperial - infection, 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch