The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of PTS system N-acetylgalactosamine-specific IIB component 1 from Escherichia coli. To be Published
    Site NYSGXRC
    PDB Id 3eye Target Id NYSGXRC-13945a
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS24499,PF03830, AAN82336.1 Molecular Weight 17607.37 Da.
    Residues 158 Isoelectric Point 6.28
    Sequence msspnilltridnrlvhgqvgvtwtstiganllvvvddvvanddiqqklmgitaetygfgirfftiekt invigkaaphqkiflicrtpqtvrklveggidlkdvnvgnmhfsegkkqisskvyvddqdltdlrfikq rgvnvfiqdvpgdqkeqipd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.45 Rfree 0.221
    Matthews' coefficent 2.00 Rfactor 0.190
    Waters 171 Solvent Content 38.47

    Ligand Information


    Google Scholar output for 3eye

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch