.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ewb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of N-terminal domain of putative 2-isopropylmalate synthase from Listeria monocytogenes. To be Published
    Site NYSGXRC
    PDB Id 3ewb Target Id NYSGXRC-13572a
    Molecular Characteristics
    Source Listeria monocytogenes
    Alias Ids TPS24495,AAT04780.1, PF00682 Molecular Weight 56061.24 Da.
    Residues 512 Isoelectric Point 5.21
    Sequence mkkiqffdttlrdgeqtpgvnfdvkekiqialqleklgidvieagfpisspgdfecvkaiakaikhcsv tglarcvegdidraeealkdavspqihiflatsdvhmeyklkmsraevlasikhhisyarqkfdvvqfs pedatrsdraflieavqtaidagatvinipdtvgytnptefgqlfqdlrreikqfddiifashchddlg matanalaaiengarrvegtingigeragntaleevavalhirkdfyqaetnivlnqfknssdlisrls gmpvprnkaviggnayahesgihqdgvlknpdtyeiitpalvgvdknslplgklsgkhafntrmeemgy tlteqeqkdafkrfkqladakkevteedlhalilgqssesaddfelkhlqvqyvtggvqgaivrieerd galvedaatgsgsieaiyntinrlmkqdieltdyriqaitagqdaqaevhvvikndkgavfhgigidfd vltasakaylqasgksktaskqadfeevk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.245
    Matthews' coefficent 2.44 Rfactor 0.194
    Waters 109 Solvent Content 49.68

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ewb
    1. Structural and Functional Characterization of _-Isopropylmalate Synthase and Citramalate Synthase, members of the LeuA Dimer Superfamily
    PA Frantom - Archives of Biochemistry and Biophysics, 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch