The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of methyltransferase from Pyrococcus furiosus. To be Published
    Site NYSGXRC
    PDB Id 3evz Target Id NYSGXRC-11120i
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS27053,NP_578576.1, Molecular Weight 27904.09 Da.
    Residues 248 Isoelectric Point 9.36
    Sequence mvvwkdgklglpipeavkiipelnnyvingkldfsnrqarilynkaiakalfgldieyhpkglvttpis ryiflktflrggevaleigtghtammalmaekffnckvtatevdeeffeyarrniernnsnvrlvksng giikgvvegtfdvifsappyydkplgrvltereaigggkygeefsvklleeafdhlnpggkvalylpdk ekllnvikergiklgysvkdikfkvgtrwrhsliffkgisv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.25900
    Matthews' coefficent 2.00 Rfactor 0.19916
    Waters 51 Solvent Content 38.57

    Ligand Information


    Google Scholar output for 3evz

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch