The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of phosphoglycerate dehydrogenase from Lactobacillus plantarum. To be Published
    Site NYSGXRC
    PDB Id 3evt Target Id NYSGXRC-11154g
    Molecular Characteristics
    Source Lactobacillus plantarum
    Alias Ids TPS24534,NP_786166.1, Molecular Weight 34257.40 Da.
    Residues 316 Isoelectric Point 6.13
    Sequence mpmvlmaqatkpeqlqqlqttypdwtfkdaaavtaadydqievmygnhpllktilarptnqlkfvqvis agvdylplkalqaagvvvantsgihadaisesvlaamlsvvrgyhaawlnqrgarqwalpmttstltgq qlliygtgqigqslaakasalgmhvigvnttghpadhfhetvaftatadalatanfivnalpltptthh lfstelfqqtkqqpmlinigrgpavdttalmtaldhhqlsmaaldvtepeplptdhplwqrddvlitph isgqiahfratvfpifaanfaqfvkdgtlvrnqvdlnrgy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.288
    Matthews' coefficent 2.20 Rfactor 0.230
    Waters 89 Solvent Content 44.04

    Ligand Information


    Google Scholar output for 3evt

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch