.
The Open Protein Structure Annotation Network
PDB Keyword
.

3evn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF putative Gfo/Idh/MocA family oxidoreductase from Streptococcus agalactiae 2603V/r. To be Published
    Site NYSGXRC
    PDB Id 3evn Target Id NYSGXRC-11129i
    Molecular Characteristics
    Source Streptococcus agalactiae
    Alias Ids TPS24530,AAM99349.1, 3.40.50.720 Molecular Weight 35517.03 Da.
    Residues 319 Isoelectric Point 6.41
    Sequence mskvrygvvstakvaprfiegvrlagngevvavssrtlesaqafankyhlpkaydkledmladesidvi yvatinqdhykvakaallagkhvlvekpftltydqanelfalaescnlflmeaqksvfipmtqvikkll asgeigevisissttaypnidhvtwfrelelgggtvhfmapyalsylqylfdatithasgtatfpkgqs dsqsklllqlsngvlvdiflttrlnlphemiiygtegrliiphfwktthaklvrndtsartiqvdmvsd fekeayhvsqmilegqrvshimtpqltlsgvkiiedlyrswgk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.285
    Matthews' coefficent 2.43 Rfactor 0.205
    Waters 194 Solvent Content 49.29

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3evn

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch