The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative transcriptional regulator protein from Vibrio parahaemolyticus. To be Published
    Site NYSGXRC
    PDB Id 3er6 Target Id NYSGXRC-11174o
    Molecular Characteristics
    Source Vibrio parahaemolyticus
    Alias Ids TPS24538,NP_800226.1, Molecular Weight 37106.54 Da.
    Residues 327 Isoelectric Point 6.80
    Sequence lketnkknlrvvalaptgryfasiissleiletaaefaefqgfmthvvtpnnrpligrggisvqptaqw qsfdftniliigsigdplesldnidpalfdwirelhlkgskivaidtgifvvakagllqqnkavmhsyf ahlfgelfpeimlmteqkalidgnvylssgpyshssvmleiveeyfgkhtrnlgnqflstiessgnshs ycdvfrymqhrdelilkiqkwilttdldivsisdlaneaclserqlkrrfkeatsisplkfiqlgrlsf akellrstklsidevasrsgyvdtqffrqifkrendcspleyrkrnqvkae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.90 Rfree 0.231
    Matthews' coefficent 2.33 Rfactor 0.192
    Waters 557 Solvent Content 47.10

    Ligand Information


    Google Scholar output for 3er6

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch