The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative HAD superfamily hydrolase from Streptococcus agalactiae. To be Published
    Site NYSGXRC
    PDB Id 3epr Target Id NYSGXRC-9646a
    Molecular Characteristics
    Source Streptococcus agalactiae
    Alias Ids TPS24516,77413177, PF00702 Molecular Weight 28059.58 Da.
    Residues 256 Isoelectric Point 4.56
    Sequence maykgylidldgtiykgksripagerfierlqekgipymlvtnnttrtpesvqemlrgfnvetpletiy tatmatvdymndmnrgktayvigeeglkkaiadagyvedtknpayvvvgldwnvtydklatatlaiqng alfigtnpdlniptergllpgagslnalleaatrikpvfigkpnaiimnkaleilniprnqavmvgdny ltdimaginndidtllvttgfttveevpdlpiqpsyvlasldewtfneg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.55 Rfree 0.209
    Matthews' coefficent 2.92 Rfactor 0.179
    Waters 282 Solvent Content 57.91

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals NA (SODIUM) x 1


    Google Scholar output for 3epr

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch