The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative mandelate racemase/muconate lactonizing enzyme from Silicibacter pomeroyi. To be Published
    Site NYSGXRC
    PDB Id 3eez Target Id NYSGXRC-9394o
    Molecular Characteristics
    Source Silicibacter pomeroyi
    Alias Ids TPS20414,56696478 Molecular Weight 39783.30 Da.
    Residues 368 Isoelectric Point 5.51
    Sequence mkitritvyqvdlplehpywlsggrlkfelldatlvkletdagitgwgegtpwghtyvpahgpgiragi etmapfvlgldprrlldveramdialpghlyakspidmacwdiagqaaglpiadlmgggsrtprpiass vgaksveetravidryrqrgyvahsvkiggdverdiarirdvedirkpgeivlydvnrgwtrqqalrvm ratedlhvmfeqpgetlddiaairplhsapvsvdeclvtlqdaarvardglaevfgiklnrvggltraa rmrdialahgidmfvmatggsvladaealhlaatipdhachavwacqdmltvdiaggrgprnidghlhl petpglgvhpdedalgdpvavys
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.279
    Matthews' coefficent 4.48 Rfactor 0.228
    Waters 4 Solvent Content 72.54

    Ligand Information


    Google Scholar output for 3eez

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch