The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Rrna-Methylase from Clostridium Thermocellum. To be Published
    Site NYSGXRC
    PDB Id 3eey Target Id NYSGXRC-11114c
    Molecular Characteristics
    Source Clostridium thermocellum
    Alias Ids TPS20430,ABN51931.1, Molecular Weight 20726.75 Da.
    Residues 188 Isoelectric Point 5.38
    Sequence mqtiknslgqshdyikmfvkegdtvvdatcgngndtaflaslvgengrvfgfdiqdkaianttkkltdl nlidrvtlikdghqnmdkyidcpvkavmfnlgylpsgdhsistrpettiqalskamellvtggiitvvi yyggdtgfeekekvleflkgvdqkkfivqrtdfinqancppilvciekis
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.27843
    Matthews' coefficent 2.53 Rfactor 0.24361
    Waters 361 Solvent Content 51.41

    Ligand Information


    Google Scholar output for 3eey

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch