The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Mut/NUDIX family protein from Bacillus thuringiensis. To be Published
    Site NYSGXRC
    PDB Id 3eds Target Id NYSGXRC-11181d
    Molecular Characteristics
    Source Bacillus thuringiensis
    Alias Ids TPS20452,, YP_895274.1 Molecular Weight 22095.30 Da.
    Residues 194 Isoelectric Point 4.64
    Sequence lsylkmiesyllvvlgsfsypfyieivigiiiqwvsentvfingvgenymsmslyykkireqlghelif ipsvaavikneqgeilfqypggeywslpagaielgetpeeavvrevweetglkvqvkkqkgvfggkeyr ytysngdeveyivvvfecevtsgelrsidgeslklqyfslsekpplalpypdkifl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.76 Rfree 0.275
    Matthews' coefficent 1.99 Rfactor 0.243
    Waters 115 Solvent Content 38.05

    Ligand Information


    Google Scholar output for 3eds

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch