The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative short-chain dehydrogenase/reductase from Corynebacterium glutamicum. To be Published
    Site NYSGXRC
    PDB Id 3e9n Target Id NYSGXRC-11150d
    Molecular Characteristics
    Source Corynebacterium glutamicum
    Alias Ids TPS20446,, NP_601642.1 Molecular Weight 25286.30 Da.
    Residues 236 Isoelectric Point 5.39
    Sequence mkkkiavvtgatggmgieivkdlsrdhivyalgrnpehlaalaeiegvepiesdivkevleeggvdklk nldhvdtlvhaaavardttieagsvaewhahldlnvivpaelsrqllpalraasgcviyinsgagngph pgntiyaaskhalrgladafrkeeanngirvstvspgptntpmlqglmdsqgtnfrpeiyiepkeiana irfvidagettqitnvdvrprieladrkd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.40 Rfree 0.276
    Matthews' coefficent 2.20 Rfactor 0.229
    Waters 127 Solvent Content 44.18

    Ligand Information


    Google Scholar output for 3e9n

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch