The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a possible transglutaminase-family protein proteolytic fragment from Bacteroides fragilis. To be Published
    Site NYSGXRC
    PDB Id 3e8v Target Id NYSGXRC-12019a
    Molecular Characteristics
    Source Bacteroides fragilis
    Alias Ids TPS20403,PF01841, YP_210728.1 Molecular Weight 100320.24 Da.
    Residues 892 Isoelectric Point 5.46
    Sequence mktltrfliipmlsvaffscseshflkdvayrnqvtqdfemkkqqlpngelfavfnekltipeqealmf lyaymptgdvtdytgdyylenvrlsdqarrempwgkeipddvfrhfvlpirvnnenlddsrrvfynelk drvknlslhdavlevnhwchekviytpsdartsaplasvktaygrcgeestftvaalrsvgiparqvyt prwahtddnhawveawvdgkwyffgacepepvlnlgwfnapasrgmlmhtkvfgrytgqeeimyetpny teinvidnyaptakgsvlvtdaegqpvadatvefkvynyaefytvatkhtdrsghasltagkgdmlvwa skdgrfgysklsfgkdnelkitldknasetyslpldivppaeganlpevtpeqrtendrrmaqedsirn ayvatfiteeqartfakenkldetetvrlliasrgnhqtltdflsdavkadkagqaisllkvvsakdlr dvspevlndhlnnsglpasedfcsnvlnprvanemitpykaffrkeipaseaeafrknpqalvewckke itinnelnsqripmspmgvwkarvadeksrniffvsmarslgipawidevtgkiqyrtfndnnlkngkv ydvdfeaaqqtqaptgtlvaryrpipslsdpkyyshftlskfrngtfqllnydegdvdmgggatwsnll kngarldtgyymmvtgtrmasgavlanvtfftieegktttvdlvmreskdqvqvignfnsestylpigt sepqsilqtcgrgyyvvavlgagqeptnhalrdiaalsgefekwgrkmvllfpseeqykkfrpsefpgl pstitygidvdgaiqkqiaesmklpnstilpmfiigdtfnrvvfvsqgytiglgeqlmkvihgl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.243
    Matthews' coefficent 3.52 Rfactor 0.225
    Waters 5 Solvent Content 65.09

    Ligand Information
    Metals UNL (UNKNOWN) x 1


    Google Scholar output for 3e8v

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch