.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e3m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a LacI family transcriptional regulator from Silicibacter pomeroyi. To be Published
    Site NYSGXRC
    PDB Id 3e3m Target Id NYSGXRC-11021d
    Molecular Characteristics
    Source Silicibacter pomeroyi
    Alias Ids TPS20422,3.40.50.2300, Q5LKY7_SILPO, PF00532 Molecular Weight 38247.87 Da.
    Residues 346 Isoelectric Point 8.81
    Sequence mdsrkpghrpvtmrdvakaagvsrmtvsralkkdspissetrerilkvvkdmnyvpdqvagslttkrsg fvglllpslnnlhfaqtaqsltdvleqgglqlllgytayspereeqlvetmlrrrpeamvlsydghteq tirllqrasipiveiwekpahpightvgfsneraaydmtnallargfrkivflgekdddwtrgaarrag fkramreaglnpdqeirlgapplsiedgvaaaelilqeypdtdcifcvsdmpafgllsrlksigvavpe qvsvvgfgnfevsrfaspeistvrvdpiaigretgslilrlldpkqrspqtaqhitlppvlefrpslknl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.60 Rfree 0.215
    Matthews' coefficent 2.03 Rfactor 0.184
    Waters 1036 Solvent Content 39.47

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3e3m

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch