.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e05

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF Precorrin-6y C5,15-methyltransferase from Geobacter metallireducens. To be Published
    Site NYSGXRC
    PDB Id 3e05 Target Id NYSGXRC-11113e
    Molecular Characteristics
    Source Geobacter metallireducens
    Alias Ids TPS24526,ABB30724.1, 3.40.50.150 Molecular Weight 44715.05 Da.
    Residues 405 Isoelectric Point 5.21
    Sequence mphqkiylvgagiegwegfgakalevigkaevlvghkrhldifsdftgkkqelgdlsilleqlrstdkr tvvlgsgdpnffgiarfllrnlpkerieifpnvtsvqyafaqikepwddaifvsvhgrglkgavdriva aekvavltdktnspaaiareliargaegyeawlcenlglpgekftrtdvkgllelpaaelnililikaw epqlaqypvigidddefatakklitkqevravtlsklrlqddlvmwdigagsasvsieasnlmpngrif alernpqylgfirdnlkkfvarnvtlveafapeglddlpdpdrvfiggsggmleeiidavdrrlksegv ivlnavtldtltkavefledhgymvevacvnvaktkglteykmfeshnpvyiitawksde
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 1.80 Rfree 0.26179
    Matthews' coefficent 2.14 Rfactor 0.21572
    Waters 537 Solvent Content 42.47

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals CL (CHLORIDE) x 8

    Jmol

     
    Google Scholar output for 3e05
    1. Transformative Concepts for Drug Design: Target Wrapping
    A Fernndez - 2010 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch