.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dzb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Prephenate dehydrogenase from Streptococcus thermophilus.
    Site NYSGXRC
    PDB Id 3dzb Target Id NYSGXRC-11134a
    Molecular Characteristics
    Source Streptococcus thermophilus
    Alias Ids TPS20440,AAV60348.1, 3.40.50.720 Molecular Weight 41158.54 Da.
    Residues 368 Isoelectric Point 5.44
    Sequence mskktiyiaglgliggslalgikrdhpdyeilgynrsdysrnialergivdratgdfkefapladviila vpikqtmaylkeladldlkdnviitdagstkreiveaaeryltgknvqfvgshpmagshksgaiaadvt lfenayyiftptsltkettipelkdilsglksryveidaaehdrvtsqishfphllasglmeqaadyaq ahemtnhfaaggfrdmtriaesepgmwasilmtngpavldriedfkkrldhvadlikaedesaiweffd ngrkkrkemeihkkggvesafdifvdvpdredvilsimellrgtslvnirineenredihgilqitfkn ekdrkhartvieantdyhvvia
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.46 Rfree 0.278
    Matthews' coefficent 2.39 Rfactor 0.234
    Waters 60 Solvent Content 48.54

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3dzb
    1. The structure of Haemophilus influenzae prephenate dehydrogenase suggests unique features of bifunctional TyrA enzymes
    HJ Chiu, P Abdubek, T Astakhova - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch