.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dxi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the N-terminal domain of a putative aldolase (BVU_2661) from Bacteroides vulgatus. To be Published
    Site NYSGXRC
    PDB Id 3dxi Target Id NYSGXRC-11107n
    Molecular Characteristics
    Source Bacteroides vulgatus
    Alias Ids TPS20428,3.20.20.70, YP_001299935.1 Molecular Weight 57699.74 Da.
    Residues 510 Isoelectric Point 6.48
    Sequence mkildctlrdggyytnwdfnskivdayilamnelpidylevgyrnkpskeymgkfgytpvsvlkhlrni stkkiaimlneknttpedlnhlllpiiglvdmiriaidpqnidraivlakaiktmgfevgfnvmymskw aemngflsklkaidkiadlfcmvdsfggitpkevknllkevrkythvpvgfhghdnlqlglinsitaid dgidfidatitgmgrgagnlkmellltylnkhhglnvdfnvlgniittftpllekyqwgtnlpymlsga nnipqkevmdwvtnrvysfnsiiraldnrknkmednakypllniknkfdrvviigggfnaiehkeaiks fiethtntaiifataryareyldvnaphfyclvgneghrlthninpqnlsgicvlppyprpmgtevpey aknvtfelenitfidqykdsvttialqlailltdqdiylvgydgypgnvlsekemaltnenrtifatyt tisgkilksltpsiykeievvsvyqfi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.04 Rfree 0.2316
    Matthews' coefficent 2.25 Rfactor 0.1965
    Waters 457 Solvent Content 45.37

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3dxi

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch