.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dup

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Mutt/Nudix Family Hydrolase from Rhodospirillum Rubrum. To be Published
    Site NYSGXRC
    PDB Id 3dup Target Id NYSGXRC-11180a
    Molecular Characteristics
    Source Rhodospirillum rubrum
    Alias Ids TPS20450,3.90.79.10, YP_425306.1 Molecular Weight 32209.99 Da.
    Residues 292 Isoelectric Point 6.20
    Sequence lsflkhvqdcnthdlsnfvrfviegrrvgwvrkalaqrlkahgrvfdvtrdavllsaslrtpqsrtrav advvdrladegvvpaprgelyrvnqswgeptlmlldravvptfgvraygvhlngyvgagadlhlwigrr spdksvapgkldnmvaggqpadlslrqnlikecaeeadlpealarqaipvgaitycmespagikpdtlf lydlalpedfrphntdgemadfmlwpaakvveavrtteafkfnvnltvidfairhglidpdnepdyqei laglrgrpreraaspa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.20762
    Matthews' coefficent 3.36 Rfactor 0.1694
    Waters 678 Solvent Content 63.40

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2;GOL (GLYCEROL) x 7
    Metals

    Jmol

     
    Google Scholar output for 3dup
    1. The Fragment-based Consistency Score in Model Quality Assessment for De Novo Prediction of Protein Structures
    H Cetin, TN Sasaki, M Sasai - Chem-Bio Informatics Journal, 2011 - J-STAGE
     
    2. ___________________________________
    H Cetin_ _____ ____ - CBI _____, 2011 - J-STAGE
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch