.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dp7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF SAM-dependent methyltransferase from Bacteroides vulgatus ATCC 8482. To be Published
    Site NYSGXRC
    PDB Id 3dp7 Target Id NYSGXRC-11126e
    Molecular Characteristics
    Source Bacteroides vulgatus
    Alias Ids TPS14659,YP_001298330.1, 3.40.50.150 Molecular Weight 40572.30 Da.
    Residues 356 Isoelectric Point 5.54
    Sequence mmhkrytkeqctaaeaqrlaqeiafgpvvfqvsrlmlkfgifqllsgkregytlqeisgrtgltryaaq vlleasltigtilleedryvlakagwfllndkmarvnmefnhdvnyqglfhleeallngrpeglkvfge wptiyeglsqlpeqvqkswfgfdhfysdqsfgkaleivfshhpkrlldiggntgkwatqcvqynkevev tivdlpqqlemmrkqtaglsgserihghganlldrdvpfptgfdavwmsqfldcfseeevisiltrvaq sigkdskvyimetlwdrqryetasycltqislyftamangnskmfhsddlircienagleveeiqdnig lghsilqcrlk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.33 Rfree 0.253
    Matthews' coefficent 3.66 Rfactor 0.183
    Waters 90 Solvent Content 66.37

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3dp7

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch