.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dby

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized protein from Bacillus cereus G9241. To be published
    Site NYSGXRC
    PDB Id 3dby Target Id NYSGXRC-10509a
    Molecular Characteristics
    Source Bacillus thuringiensis
    Alias Ids TPS9413,A0RA72_BACTU Molecular Weight 30301.51 Da.
    Residues 260 Isoelectric Point 5.93
    Sequence lvernyeesalfehqfwlkvltdhaqflldalapkekedikkaiyfvetftnllnkvhnvnlvafskea eqaakeirmfklniiqkqlegkitihftptfinhmvneveeyitvleflkkgevppvfhelhyhlvwlt daaghagsisggldlvekrlkkkseefekhfeqfylkavemtgylrtelhhfpalkkftkdvslelklf shflheveelelsneilsalsarmadhmareecyyllklaqssglempkcnpl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 20
    Resolution (Å) 2.10 Rfree 0.258
    Matthews' coefficent 2.51 Rfactor 0.198
    Waters 2073 Solvent Content 51.05

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 2
    Metals FE (FE) x 40

    Jmol

     
    Google Scholar output for 3dby
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch