The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative glycosylase ydhD from Bacillus subtilis. To be Published
    Site NYSGXRC
    PDB Id 3cz8 Target Id NYSGXRC-11097p
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS7900,CAB12390.1, Molecular Weight 48961.07 Da.
    Residues 439 Isoelectric Point 9.01
    Sequence mfihivgpgdslfsigrrygasvdqirgvngldetnivpgqalliplyvytvqprdtltaiaakafvpl erlraanpgispnalqagakitipsisnyiagtlsfyvlrnpdldrelindyapysssisifeyhiapn gdianqlndaaaiettwqrrvtplatitnltsggfsteivhqvlnnptartnlvnniydlvstrgyggv tidfeqvsaadrdlftgflrqlrdrlqaggyvltiavpaktsdnipwlrgydyggigavvnymfimayd whhagsepgpvapiteirrtieftiaqvpsrkiiigvplygydwiipyqpgtvasaisnqnaieramry qapiqysaeyqspffrysdqqgrthevwfedvrsmsrkmqivreyrlqaigawqltlalrrahgfcgnf lrsekckkrhqslgvffliksraae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.25793
    Matthews' coefficent 2.72 Rfactor 0.19597
    Waters 192 Solvent Content 54.73

    Ligand Information
    Ligands GOL (GLYCEROL) x 8


    Google Scholar output for 3cz8

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch