.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cvg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a periplasmic putative metal binding protein. To be Published
    Site NYSGXRC
    PDB Id 3cvg Target Id NYSGXRC-10494h
    Molecular Characteristics
    Source Coccidioides immitis
    Alias Ids TPS8051,Q1DXA6_COCIM Molecular Weight 33607.52 Da.
    Residues 305 Isoelectric Point 7.75
    Sequence mlstrvlflcvlqfvagilavdpedvydggygskhspvqlrignggagqsglvkeladafikskvdsgs apfkvawyksdttvtinylkdgivdvgityspvaerisikhgisespsyyafrdhfmligppsnpakls gdsdiadmfskmhdaaeagntkppvrflsrydksatnikeaelwlsigqvpwataystwyhqyitfpiq altaaillreytitdygtylsiprglrdqmviykkgtndaddpllnpahllvgaraknaemakefakwl vskeggqkviegfkkdgqqlyspapyrhi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.97 Rfree 0.289
    Matthews' coefficent 2.52 Rfactor 0.259
    Waters 520 Solvent Content 51.21

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 4

    Jmol

     
    Google Scholar output for 3cvg
    1. A structural classification of substrate-binding proteins
    RPA Berntsson, SHJ Smits, L Schmitt, DJ Slotboom - FEBS letters, 2010 - Elsevier
     
    2. A structural classification of substrate-binding proteins
    PAB Ronnie, SHJ Smits, L Schmitt, DJ Slotboom - FEBS , 2010 - gbb.eldoc.ub.rug.nl
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch