.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cu5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a two component transcriptional regulator AraC from Clostridium phytofermentans ISDg. To be Published
    Site NYSGXRC
    PDB Id 3cu5 Target Id NYSGXRC-11009q
    Molecular Characteristics
    Source Clostridium phytofermentans
    Alias Ids TPS7870,3.40.50.2300, Q1FKY3_9CLOT, PF00072 Molecular Weight 61163.66 Da.
    Residues 531 Isoelectric Point 6.62
    Sequence mrilivddekltrdglianinwkalsfdqidqaddginaiqialkhppnvlltdvrmprmdgielvdni lklypdcsvifmsgysdkeylkaaikfrairyvekpidpseimdalkqsiqtvlqhqaqqdsnvlyake avsrfaqrlthngydmksdtliddavlrgsinnstifttcilriispynvivdrsnlssylenfdkqia kwhlneihfikndslivlhiygnerpeesvvskigtyiksvipielnyfitfgktvtgpskvfdsynsa aillqssfffdygsilihksspqsvssiypheflndfteaireknflrarelvetlyrslknnktlltn vikdmyykaflqinsvqydlklqtenavsdsesmldnitnciilnelhqmllakidrfeeklqstpket stiflirdyisnhygdyslsikdisdhvrlsfsylctvfktetgetlnqyitnyriekakqllsdprnk iievssrvgyadnnyfgkifkkivgitpseyrekelgrntsfyvlkkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.300
    Matthews' coefficent 2.34 Rfactor 0.183
    Waters 95 Solvent Content 47.40

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3cu5

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch