The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative AAA family ATPase from Prochlorococcus marinus subsp. pastoris. To be Published
    Site NYSGXRC
    PDB Id 3ctd Target Id NYSGXRC-10354e
    Molecular Characteristics
    Source Prochlorococcus marinus
    Alias Ids TPS8021,Q7V3J8_PROMP, BIG_278 Molecular Weight 48007.23 Da.
    Residues 429 Isoelectric Point 8.42
    Sequence mesdnlfsntyriesnapladklrpknlddffgqesilghdsllrnailndkvgniifsgppgvgkttl ieiissntrssliklnavlssikelrteianakerlrssnrktilfidevhrftsvqqdallpsiengt itfigattenpffavnkalisrarifsllplnkndlkkiidkvikyysclkdskvveikeeainhlikf sggdarnlinalelgisitkenkenlvvidlaiaedsiqkknivydkngqnhfdvisafiksirgsdpd atlywlanmveagedpnfifrrllisacedigladpnaivvvqsccdafdrvgfpeglfflsqaslyla ispksnstksifkaleaikatnvslvpnhlknnasnylnphnyqgkwlqqeylptdlqgikfwkpkdsg weknkyedlpkkqks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.275
    Matthews' coefficent 2.08 Rfactor 0.211
    Waters 58 Solvent Content 40.85

    Ligand Information


    Google Scholar output for 3ctd

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch