.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cs3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of sugar-binding transcriptional regulator (LacI family) from Enterococcus faecalis. To be Published
    Site NYSGXRC
    PDB Id 3cs3 Target Id NYSGXRC-11015y
    Molecular Characteristics
    Source Enterococcus faecalis
    Alias Ids TPS7878,3.40.50.2300, PF00532, Q835X8_ENTFA Molecular Weight 35848.08 Da.
    Residues 321 Isoelectric Point 6.15
    Sequence mvgikdiakkagvsistvsyalngsskvteetrtriqaiaeelnyvpnmaartlkrrqtniigvylady ggsfygellegikkglalfdyemivcsgkkshlfipekmvdgaiildwtfptkeiekfaerghsivvld rttehrnirqvlldnrggatqaieqfvnvgskkvlllsgpekgydsqerlavstreltrfgipyeiiqg dftepsgyaaakkilsqpqtepvdvfafndemaigvykyvaetnyqmgkdiriigfdnselgafvqprl atiayskhrwgmvaaekiihlmrgeaaesehiytrfiegesfpse
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.24916
    Matthews' coefficent 3.17 Rfactor 0.20432
    Waters 49 Solvent Content 61.14

    Ligand Information
    Ligands GOL (GLYCEROL) x 1;SO4 (SULFATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 3cs3
    1. Solvated dissipative electro-elastic network model of hydrated proteins
    DR Martin, DV Matyushov - Arxiv preprint arXiv:1207.1085, 2012 - arxiv.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch