.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cnb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of signal receiver domain of DNA binding response regulator (merR) from Colwellia psychrerythraea 34H. To be Published
    Site NYSGXRC
    PDB Id 3cnb Target Id NYSGXRC-11021u
    Molecular Characteristics
    Source Colwellia psychrerythraea
    Alias Ids TPS7888,3.40.50.2300, Q47UF8_COLP3, PF00072 Molecular Weight 21294.75 Da.
    Residues 192 Isoelectric Point 7.95
    Sequence ldiskkslltpaeaakllhvapttirhwaqigrlpfistpgghrrfdrndilslmstpkinvkndfsil iieddkefadmltqflenlfpyakikiaynpfdagdllhtvkpdvvmldlmmvgmdgfsichrikstpa taniiviamtgaltddnvsrivalgaetcfgkplnftllektikqlveqkkats
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.00 Rfree 0.25605
    Matthews' coefficent 2.48 Rfactor 0.20641
    Waters 170 Solvent Content 50.34

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3cnb

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch