.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cmk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis of inhibition of an Encephalitozoon cuniculi methionine aminopeptidase type 2. To be Published
    Site NYSGXRC
    PDB Id 3cmk Target Id NYSGXRC-9201a
    Related PDB Ids 3d0d 2nw5 
    Molecular Characteristics
    Source Encephalitozoon cuniculi
    Alias Ids TPS7772,NP_586190, PF00557 Molecular Weight 39973.33 Da.
    Residues 358 Isoelectric Point 5.97
    Sequence mkcillnqaeelpieflpkdgvygkgklfdsrnmeienftesdilqdarraaeahrraryrvqsivrpg itlleivrsiedstrtllkgernngigfpagmsmnscaahytvnpgeqdivlkeddvlkidfgthsdgr imdsaftvafkenlepllvaaregtetgikslgvdvrvcdigrdinevissyeveiggrmwpirpisdl hghsisqfrihggisipavnnrdttrikgdsfyavetfattgkgsiddrppcshfvlntyksrklfnkd likvyefvkdslgtlpfsprhldyyglvkggslksvnlltmmglltpypplndidgckvaqfehtvyls ehgkevltrgddy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.229
    Matthews' coefficent 2.38 Rfactor 0.178
    Waters 227 Solvent Content 48.33

    Ligand Information
    Ligands FUG (FUMAGILLIN) x 2;SO4 (SULFATE) x 3
    Metals CO (COBALT) x 4

    Jmol

     
    Google Scholar output for 3cmk

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch