.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cg4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Response Regulator Receiver Domain Protein (Chey-Like) from Methanospirillum hungatei JF-1. To be Published
    Site NYSGXRC
    PDB Id 3cg4 Target Id NYSGXRC-11024g
    Molecular Characteristics
    Source Methanospirillum hungatei
    Alias Ids TPS7891,Q2FQ04_METHJ, 3.40.50.2300, PF00072 Molecular Weight 14952.37 Da.
    Residues 137 Isoelectric Point 4.53
    Sequence maehkgdvmivdddahvriavktilsdagfhiisadsggqcidllkkgfsgvvlldimmpgmdgwdtir aildnsleqgiaivmltaknapdakmiglqeyvvdyitkpfdnedliekttffmgfvrnqtgngttte
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.61 Rfree 0.22596
    Matthews' coefficent 2.13 Rfactor 0.20136
    Waters 107 Solvent Content 42.24

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 3cg4
    1. Receiver domain structure and function in response regulator proteins
    RB Bourret - Current opinion in microbiology, 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch