.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cbn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a conserved protein (MTH639) from Methanobacterium thermoautotrophicum. To be Published
    Site NYSGXRC
    PDB Id 3cbn Target Id NYSGXRC-10241d
    Molecular Characteristics
    Source Methanobacterium thermoautotrophicum
    Alias Ids TPS8008,O26735_METTH, DUF371 Molecular Weight 18148.61 Da.
    Residues 161 Isoelectric Point 5.24
    Sequence lpvelfflgpaetqffhgdpmgvlrytlrarghpnvtaghrttfevtvdpeigetadciigvsssdsis tlpdemkraiaresslvrvilrtengydeirgyghpeltldhptdivcrksdyicsrtlmiradkaafd ldenlvrdlrkgrelkveiivey
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.63 Rfree 0.244
    Matthews' coefficent 1.72 Rfactor 0.213
    Waters 126 Solvent Content 28.30

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3cbn

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch