The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized protein PF0695. To be Published
    Site NYSGXRC
    PDB Id 3cax Target Id NYSGXRC-10381i
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS8025,PF00989, Q8U2Y3_PYRFU, BIG_803 Molecular Weight 55802.91 Da.
    Residues 475 Isoelectric Point 5.83
    Sequence mltqgrrkkttkpstawltswrkrlevsevtellnnleykkeqlkklllrihegesveklkeefrtvls nispleiplieqelvkegisardiakmcdlhvelfreavkgtgeveekdlpeghplktlyqenkeimkd aemlnlyaktlattkdermreeilgvleeivsslrmvgfthynreemlifpyierrgltviatvlwtkh deiramikqlaellrkreempweefvekfkakagevafalsdmvfrennifyptlkallsegewkaikm qedeigyykvkppewdpgedvkplhpweinpelnveqlltlpkevqqalrgqplefdktqlkreedidl gtgylnieelkaifealpvdvtfidkddrvrffspgeriftrtpsvlgrpvqlchppksvyvvnkilka fkegrkkeatfwlrlrekyvyikyvplfnekgeyigtlemtmdiapykkiegekrlldwrd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.43 Rfree 0.226
    Matthews' coefficent 3.73 Rfactor 0.185
    Waters 75 Solvent Content 67.02

    Ligand Information


    Google Scholar output for 3cax
    1. Structural and Sequence Analysis of Imelysin-Like Proteins Implicated in Bacterial Iron Uptake
    Q Xu, ND Rawlings, CL Farr, HJ Chiu, JC Grant - PloS one, 2011 - dx.plos.org

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch