.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c4r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized protein encoded by cryptic prophage. To be Published
    Site NYSGXRC
    PDB Id 3c4r Target Id NYSGXRC-10179a
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS7991,PF06254, Q8FIL0 Molecular Weight 15966.48 Da.
    Residues 141 Isoelectric Point 6.30
    Sequence mkikhehirmamnawahpdgekvpaaeitrayfelgmtfpelyddshpealarntqkifrwvekdtpda vekiqallpaieksmppllvarmrshssayfrelvetrerlvrdaddfvavaiagfnqmnrggpagniv avh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.282
    Matthews' coefficent 2.45 Rfactor 0.242
    Waters 65 Solvent Content 49.87

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3c4r

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch