.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c3m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the N-terminal domain of response regulator receiver protein from Methanoculleus marisnigri JR1. To be Published
    Site NYSGXRC
    PDB Id 3c3m Target Id NYSGXRC-11010e
    Molecular Characteristics
    Source Unknown
    Alias Ids TPS7871,Q0YAX5_9EURY, 3.40.50.2300, PF00072 Molecular Weight 24208.45 Da.
    Residues 212 Isoelectric Point 4.81
    Sequence mmytilvvddspmivdvfvtmlerggyrpitafsgeeclealnatppdlvlldimmepmdgwetlerik tdpatrdipvlmltakpltpeeaneygsyiedyilkptthhqlyeaiehvlarrhsiaadierareagv dshlvdeyerlaksvdinrrllkilettysikdaragmgeditraiksmavsikiqeerlnqvrnqfee lfvar
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.19318
    Matthews' coefficent 2.80 Rfactor 0.16378
    Waters 157 Solvent Content 56.01

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 3c3m
    1. Receiver domain structure and function in response regulator proteins
    RB Bourret - Current opinion in microbiology, 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch