.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bzw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative lipase from Bacteroides thetaiotaomicron. To be Published
    Site NYSGXRC
    PDB Id 3bzw Target Id NYSGXRC-12063b
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron
    Alias Ids TPS7768,NP_811873.1, PF00657 Molecular Weight 32543.56 Da.
    Residues 285 Isoelectric Point 5.80
    Sequence mknrfliictvlflssclaygqeqasvtndfsenkqgciqhpwqgkkvgyigdsitdpncygdnikkyw dflkewlgitpfvygisgrqwddvprqaeklkkehggevdailvfmgtndynssvpigewfteqeeqvl sahgemkkmvtrkkrtpvmtqdtyrgrinigitqlkklfpdkqivlltplhrslanfgdknvqpdesyq ngcgeyidayvqaikeagniwgipvidfnavtgmnpmveeqliyfydagydrlhpdtkgqermartlmy qllalpvaf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.87 Rfree 0.215
    Matthews' coefficent 2.14 Rfactor 0.190
    Waters 698 Solvent Content 42.47

    Ligand Information
    Ligands ACT (ACETATE) x 6;SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3bzw

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch