.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bt3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a glyoxalase-related enzyme from Clostridium phytofermentans. To be Published
    Site NYSGXRC
    PDB Id 3bt3 Target Id NYSGXRC-11003f
    Molecular Characteristics
    Source Clostridium phytofermentans
    Alias Ids TPS7857,PF00903, 3.10.180.10, Q1FJ26_9CLOT Molecular Weight 30390.99 Da.
    Residues 265 Isoelectric Point 5.70
    Sequence mdwqkgmnsaidyieknltgnvnvrtaagfvgcstwefqrifsflthiplseyirqrkltlaaqeikdn dvkiidialkygyespaafsrafnklfgiapssvrntennlktypritfekienerlikmsrfsergyv vrengpvyftkdmdktvkwfeeilgwsgdivarddegfgdygcvfdypsevavahltpfrgfhlfkgep ikgvagfmmiegidalhkyvkengwdqisdiytqpwgarecsitttdgcilrffesiq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.27
    Matthews' coefficent 2.81 Rfactor 0.222
    Waters 91 Solvent Content 56.27

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bt3

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch