.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bs4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized protein PH0321 from Pyrococcus horikoshii in complex with an unknown peptide. To be Published
    Site NYSGXRC
    PDB Id 3bs4 Target Id NYSGXRC-11067g
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS7894,3.40.50.300, O58059_PYRHO Molecular Weight 29603.85 Da.
    Residues 253 Isoelectric Point 8.96
    Sequence misweieeldreigkikkhsliliheedassrgkdilfyilsrklksdnlvgmfsisyplqliirilsr fgvdvikylenhrlaivdtfgsfhgikatmpgvwylegmlssetlpikyakavedhkkvwmdlnlfegr elygfaismsgylevftpeetlryletsaevryghpaykkyprgtnfwlwegvkdkrvllsvyrradyv lktrsslgengikrellviktpkpieelvrfeyefkgnepklrrvd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.208
    Matthews' coefficent 2.77 Rfactor 0.184
    Waters 192 Solvent Content 55.56

    Ligand Information
    Ligands ASN-ILE-PHE x 1
    Metals

    Jmol

     
    Google Scholar output for 3bs4

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch