.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bqx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title High resolution crystal structure of a glyoxalase-related enzyme from Fulvimarina pelagi. To be Published
    Site NYSGXRC
    PDB Id 3bqx Target Id NYSGXRC-11003j
    Molecular Characteristics
    Source Unknown
    Alias Ids TPS7858,Q0G7J9_9RHIZ, PF00903, 3.10.180.10 Molecular Weight 15015.34 Da.
    Residues 140 Isoelectric Point 4.84
    Sequence mqqvavitlgigdleasarfygegfgwapvfrnpeiifyqmngfvlatwlvqnlqedvgvavtsrpgsm alahnvraetevaplmerlvaaggqllrpadapphgglrgyvadpdghiweiafnpvwpigadgsvtfa ak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.248
    Matthews' coefficent 2.38 Rfactor 0.238
    Waters 158 Solvent Content 48.26

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bqx

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch