.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bma

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of probable D-Alanyl-Lipoteichoic Acid Synthetase from Streptococcus pneumoniae. To be Published
    Site NYSGXRC
    PDB Id 3bma Target Id NYSGXRC-10162c
    Molecular Characteristics
    Source Streptococcus pneumoniae
    Alias Ids TPS7982,PF04915, Q8DN13 Molecular Weight 49485.88 Da.
    Residues 427 Isoelectric Point 7.82
    Sequence lwsykmlkrlwmifgpvliagllvflliffyptemhhnlgaekrsavattidsfkersqkvralsdpnv rfvpffgssewlrfdgahpavlaekynrsyrpyllgqggaaslnqyfgmqqmlpqlenkqvvyvispqw fskngydpaafqqyfngdqltsflkhqsgdqasqyaatrllqqfpnvamkdlvqklaskeelstadnem iellarfnecqasffgqfsvrgyvnydkhvakylkilpdqfsyqaiedvvkadaekntsnnemgmenyf yneqikkdlkklkdsqksftylkspeyndlqlvltqfskskvnpifiippvnkkwmdyaglredmyqqt vqkiryqlesqgftniadfskdggepffmkdtihlgwlgwlafdkavdpflsnptpaptyhlnerffsk dwatydgdvkefq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.24 Rfree 0.27133
    Matthews' coefficent 2.53 Rfactor 0.21393
    Waters 795 Solvent Content 51.40

    Ligand Information
    Ligands SO4 (SULFATE) x 14;GOL (GLYCEROL) x 10
    Metals

    Jmol

     
    Google Scholar output for 3bma

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch