.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bil

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a probable LacI family transcriptional regulator from Corynebacterium glutamicum. To be Published
    Site NYSGXRC
    PDB Id 3bil Target Id NYSGXRC-11020c
    Molecular Characteristics
    Source Corynebacterium glutamicum
    Alias Ids TPS7886,3.40.50.2300, PF00532, Q8NQQ9_CORGL Molecular Weight 36566.48 Da.
    Residues 346 Isoelectric Point 5.45
    Sequence matekfrptlkdvarqagvsiatasraladnpavaastreriqqlasdlgyranaqaralrssrsntig vivpslinhyfaamvteiqstaskaglatiitnsnedattmsgslefltshgvdgiicvpneecanqle dlqkqgmpvvlvdrelpgdstiptatsnpqpgiaaavellahnnalpigylsgpmdtstgrerledfka acanskigeqlvflggyeqsvgfegatklldqgaktlfagdsmmtigvieachkaglvigkdvsvigfd thplfalqphpltvidqnveqlaqravsilteliagtvpsvtkttiptalihresiinstlrkkdglpne
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.278
    Matthews' coefficent 2.17 Rfactor 0.218
    Waters 20 Solvent Content 43.22

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bil

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch