.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bh1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein DIP2346 from Corynebacterium diphtheriae. To be Published
    Site NYSGXRC
    PDB Id 3bh1 Target Id NYSGXRC-10428a
    Molecular Characteristics
    Source Corynebacterium diphtheriae
    Alias Ids TPS8046,Y2346_CORDI, BIG_73 Molecular Weight 55122.79 Da.
    Residues 497 Isoelectric Point 5.64
    Sequence mvntigfdrekyiemqsqhirerrealggklylemggklfddmhasrvlpgftpdnkiamldrikdeve ilvcinakdlerhkiradlgisyeedvlrlvdvfrdrgflvehvvltqlendnrlalafierlqrlgik vsrhrvipgyptdmdrivsdegfglneyaettrdlvvvtapgpgsgklatclsqvyhehkrgvaagyak fetfpiwnlplehpvnlayeaatvdlndanvidhfhlaaygeqtvnynrdveafpllktllerlmgesp yqsptdmgvnmagncisddaacrhaseqeiirryfkalveeartgkdstqsdraavvmakagikasqrv vveparqveertslpgcaielvdgsiitgatsdllgcsssmllnalkhlagiddaihllspesiepiqt lktvhlgssnprlhtdevlialsvsaatdsnaqkaldqlknlrgcdvhtttilgsvdegifrnlgvlvt sdpkfqknklyqkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.51 Rfree 0.27134
    Matthews' coefficent 2.58 Rfactor 0.21068
    Waters 117 Solvent Content 52.41

    Ligand Information
    Ligands GOL (GLYCEROL) x 4
    Metals

    Jmol

     
    Google Scholar output for 3bh1

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch