.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bgh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative neuraminyllactose-binding hemagglutinin homolog from Helicobacter pylori. To be Published
    Site NYSGXRC
    PDB Id 3bgh Target Id NYSGXRC-10226a
    Molecular Characteristics
    Source Helicobacter pylori
    Alias Ids TPS8005,O25166, PF05211 Molecular Weight 28347.26 Da.
    Residues 249 Isoelectric Point 7.87
    Sequence mkkgslaivlgsllasgafytaladgmpakqqhnntgesvelhfhypikgkqepknshlvvliepkiei nkvipesyqkefekslflqlssflerkgysvsqfkdaseipqdikekallvlrmdgnvailediveesd alseekvidmssgylnlnfvepksediihsfgidvskikaviervelrrtnsggfvpktfvhriketdh dqairkimnqayhkvmvhitkelskkhmehyekvssemkkrk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.45 Rfree 0.278
    Matthews' coefficent 2.43 Rfactor 0.236
    Waters 26 Solvent Content 49.48

    Ligand Information
    Ligands SO4 (SULFATE) x 5
    Metals

    Jmol

     
    Google Scholar output for 3bgh
    1. Structural motif screening reveals a novel, conserved carbohydrate-binding surface in the pathogenesis-related protein PR-5d
    AC Doxey, Z Cheng, BA Moffatt - BMC structural , 2010 - biomedcentral.com
     
    2. STRUCTURAL AND FUNCTIONAL STUDIES ON THE HELICOBACTER PYLORI PROTEOME: THE STATE OF THE ART
    G Zanotti, L Cendron - Functional Proteomics & Nanotechnology- , 2010 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch