.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bg2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the deoxyguanosinetriphosphate triphosphohydrolase from Flavobacterium sp. MED217. To be Published
    Site NYSGXRC
    PDB Id 3bg2 Target Id NYSGXRC-10395n
    Molecular Characteristics
    Source Flavobacterium sp.
    Alias Ids TPS8030,ZP_01059381, BIG_823 Molecular Weight 50401.46 Da.
    Residues 444 Isoelectric Point 5.76
    Sequence mmnwehllslkrqgdtakrlrieqddtrlgfevdydriifsapfrslqdktqviplsktdfvhtrlths levsvvgrslgrmvgkkllekyphleqvygykfndfgaivaaaalahdignppfghsgekaigeffkng ygkrykdsltakeyqdlikfegnangfkvlsqskpgaqgglrlsyatlgafmkypkeslphkpsdhiad kkygffqseralfedvaqelgllkrsttddvswsrhplaylveaaddicytiidfedginlglipeeya leymvklvgqtidrnkynalqetsdrvsylralaigtlinesvdtfmkyeeeilagtfdqslidksnyq aqitdiinlsieriynsreviekeiagyeilstllearcraldnndthynqliqqllapndhsekslye nliqicaevstmtdgkalrnykkikgldvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.285
    Matthews' coefficent 3.30 Rfactor 0.268
    Waters 118 Solvent Content 62.75

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bg2

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch