.
The Open Protein Structure Annotation Network
PDB Keyword
.

3be3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a protein belonging to pfam DUF1653 from Bordetella bronchiseptica. To be Published
    Site NYSGXRC
    PDB Id 3be3 Target Id NYSGXRC-10206d
    Molecular Characteristics
    Source Bordetella bronchiseptica
    Alias Ids TPS8000,Q7WDN8, PF07866 Molecular Weight 9152.94 Da.
    Residues 81 Isoelectric Point 6.82
    Sequence mamqdfrpgvyrhykgdhylalglaradetdevvvvytrlyaraglpmstrllriwnetvdtgagpqpr fayvghvtpeqg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.04 Rfree 0.234
    Matthews' coefficent 2.20 Rfactor 0.201
    Waters 135 Solvent Content 43.97

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3be3

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch