.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bbl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a regulatory protein of LacI family from the Chloroflexus aggregans. To be Published
    Site NYSGXRC
    PDB Id 3bbl Target Id NYSGXRC-11012k
    Molecular Characteristics
    Source Chloroflexus aggregans
    Alias Ids TPS7875,3.40.50.2300, PF00532, A0H3S5_9CHLR Molecular Weight 37805.29 Da.
    Residues 339 Isoelectric Point 6.16
    Sequence mtatkvtlkdvaaragvsyqtvskvlngemqvapetmeriqaavqelgyrpnriarnmragrsfmigys wtqtepgqvnhildqflssmvreagavnyfvlpfpfsedrsqidiyrdlirsgnvdgfvlssinyndpr vqfllkqkfpfvafgrsnpdwdfawvdidgtagtrqaveyligrghrriailawpedsrvgndrlqgyl eamqtaqlpietgyilrgegtfevgramtlhlldlsperrptaimtlndtmaigamaaarergltigtd laiigfddapmvqylfpplssvrqpiaeagrkciellvaivegrepeqkhillqpsliirass
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.35 Rfree 0.258
    Matthews' coefficent 4.09 Rfactor 0.240
    Waters 96 Solvent Content 69.90

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 4
    Metals

    Jmol

     
    Google Scholar output for 3bbl

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch